Avoid freeze-thaw cycles. 200 μg. The anti-desmocollin 1 antibody localizes desmocollin 1 in suprabasal layers of interfollicular epidermis, specific cell layers, e.g. Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. This antibody recognizes Human antigen. Rabbit Polyclonal Desmocollin 1 antibody for IF/ICC, IHC, IP, WB. Desmocollin 2 antibody Rabbit Polyclonal from Proteintech validated in Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Enzyme-linked Immunosorbent Assay (ELISA) applications. Validated: IHC, IHC-P. Order anti-Desmocollin 1 antibody ABIN933547. Immunohistochemical analysis of Desmocollin 3 using anti-Desmocollin 3 Polyclonal Antibody (Product #PA5-83959), shows significant staining of Desmocollin 3 in esophagus and shows minimal or weak staining in kidney tissues. Desmocollins belong to the the cadherin family of calcium-dependent adhesion molecules and may mediate differential adhesiveness between cells that express different isoforms. antibodies-online.com, french (français) Anti-Desmocollin 3 Antibody Products. $365.50. Primary Antibodies are. Souris Desmocollin 1 Monoclonal anticorps pour IHC, WB. View All Primary Antibodies ; Monoclonal Antibodies antikoerper-online.de, english (english) View All Primary Antibodies ; Monoclonal Antibodies View our protocol for Staining Membrane associated Proteins. Validated for ELISA and WB. Discover more about diseases related to Desmocollin-1 Antibody (NBP1-88099). Whole cell extracts (30 μg) was separated by 7.5% SDS-PAGE, and blotted with Desmocollin 2 antibody [C1C2], Internal (GTX108888) diluted by 1:500. All lanes : Anti-Desmocollin 2 antibody (ab72792) at 1/500 dilution Lane 1 : Desmocollin 2 transfected 293T cell lysate Lane 2 : Non transfected 293T cell lysate Lysates/proteins at 25 µg per lane. The expected protein mass is 100 kDa, but there are 2 reported isoforms. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. Rabbit polyclonal Desmocollin 1 antibody. Rabbit Polyclonal Desmocollin 1 antibody for IHC (p). PRODUCT AVAILABILITY: Update Regarding the Evolving COVID-19 Situation, Bio-Techne appreciates the critical role that you and our products and services play in research efforts to further scientific innovation and discovery. Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars. Amazon.com: Desmocollin 1 Antibody: Industrial & Scientific. Order anti-Desmocollin 1 antibody ABIN6030406. Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 can be used for the detection of primary and metastatic carcinomas. The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Learn more about PTMs related to Desmocollin-1 Antibody (NBP1-88099). This product is for research use only and is not approved for use in humans or in clinical diagnosis. Desmocollin 1 is a component of intercellular desmosome junctions. Availability. This antibody reacts with human. View All Primary Antibodies ; Monoclonal Antibodies The anti-desmocollin 3 antibody localizes desmocollin 3 in living epidermal layers, glandular ducts cells, basal matrix cells, basal and suprabasal layers of stratified epithelia, and thymic reticulum cells. Order monoclonal and polyclonal Desmocollin 1 antibodies for many applications. Desmocollin1 was detected in perfusion fixed frozen sections of mouse skin using Rat Anti Human/Mouse Desmocollin1 Monoclonal Antibody (Catalog # MAB7367) at 1.7 µg/mL overnight at 4 °C. Diseases associated with DSC1 include Subcorneal Pustular Dermatosis and Iga Pemphigus.Among its related pathways are Keratinization and Innate Immune System.Gene Ontology (GO) annotations related to this gene include calcium ion binding.An important paralog of this gene is DSC2. Selected quality suppliers for anti-Desmocollin 1 antibodies. Desmocollin 1 antibody Biorbyt's Desmocollin 1 antibody is a Rabbit Polyclonal antibody. Order anti-Desmocollin 1 anticorps ABIN933547. Order anti-Desmocollin 1 antibody ABIN933547. Desmocollin-3 is one of the principal components of desmosomes which form adhesive contacts between epithelial cells (1, 2). Gene DSC1 Modification Unmodified View all of our anti-Rabbit Secondary Antibodies, Goat anti-Rabbit IgG Secondary Antibody [HRP (Horseradish Peroxidase)], Paraffin sections of canine folicular skin (dogs with pemphigus foliaceus), Immunohistochemistry-Paraffin 1:200 - 1:500. Note: Mouseover a species abbreviation on the product page to display the fullname. Exp. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Electropherogram image(s) of corresponding Simple Western lane view. Browse our Desmocollin-1 Antibody catalog backed by our Guarantee+. Mouse monoclonal Desmocollin 1 antibody Home. Anti Desmocollin 1 DSC1 Antibody product information; Anti Desmocollin 1 DSC1 Antibody is available 8 times from supplier MBS Polyclonals at Gentaur.com shop Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human fallopian tube shows very weak membranous positivity in glandular cells. The DSC1 / Desmocollin 1 Antibody has been validated for the following applications: Flow Cytometry, Immunohistochemistry, Immunohistochemistry - fixed, and … This antibody reacts with human. This antibody reacts with human, mouse samples. Desmocollin 2 antibody [C1C2], Internal detects Desmocollin 2 protein by western blot analysis. Fax +49 (0)241 95 163 155, german (deutsch) 100% Guaranteed. The Desmocollin-1 Antibody from Novus is a rabbit polyclonal antibody to Desmocollin-1. Gene DSC1 Modification Unmodified EMSY expression affects multiple components of skin barrier with relevance to atopic dermatitis Journal of Allergy and Clinical Immunology May 1 2019 [PMID: 31158401] (WB, IHC, Human), Min D, Lee W, Bae IH et al. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. Desmocollin-1 Antibodies available through Novus Biologicals. Validated in IHC and tested in Human. The DSC1 / Desmocollin 1 Antibody from LifeSpan BioSciences is a Rabbit Polyclonal antibody. Bio-Techne Purified and conjugated research monoclonal antibodies, polyclonal antibodies, & custom antibody services for your research needs. It may contribute to epidermal … Specificity of human Desmocollin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Order anti-Desmocollin 1 anticorps ABIN6566762. SDS-PAGE analysis of purified, BSA-free Desmocollin 2/3 antibody (clone 7G6) as confirmation of integrity and purity. Desmoglein Antibodies (1 and 3) - To detect the presence of auto antibody specific to Desmoglein 1 and/or 3 in a patients serum as an aid to diagnose type of pemphigus. Anti-Desmocollin 3 antibodies are available from several suppliers. The relative expression levels of Desmocollin 3 within each tissue is shown using RNA-Seq. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. 1 Product Result | Match Criteria: Description Product # Clonality Application Species Reactivity Citations MABT411; 7G6, … The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Test Resources. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest. Read our general, Discover related pathways, diseases and genes to Desmocollin-1 Antibody (NBP1-88099). Rabbit Polyclonal Anti-DSC1 Antibody. Mouse monoclonal Desmocollin 1 antibody Home. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … anti-Desmocollin 1 antibody is a Rabbit Polyclonal antibody recognizes Desmocollin 1, which can be used for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot … Application: Validated by immunofluorescence labeling (1:100) Reactivity: Human, mouse, rat. Click here for more. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Select your country/region. 200 μg. Desmocollin 1 antibody; Size Price Qty. Concentration: 0.25 mg/ml purified IgG. Select your country/region Secondary All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate at 1/2500 dilution Immunogen corresponding to synthetic peptide. There are no specific FAQs related to this product. Lapin Desmocollin 1 Polyclonal anticorps pour WB. View specifications, prices, citations, reviews, and more. It may contribute to epidermal cell positioning (stratification) by mediating differential … Germany, Phone +49 (0)241 95 163 153 Bioprinting of Biomimetic Skin containing Melanocytes. Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 recognizes both desmoplakin 1 and 2 from stratified epithelia, simple epithelia including glands, urothelium, thymic reticular epithelium, hepatocytes, intercalated disks of myocardium and arachnoid cells of meninges. Primary Antibodies . Dermatol. 100 μg. Rabbit Polyclonal Desmocollin 1 antibody for ELISA, FACS, IHC, WB. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human skin shows moderate to strong membranous positivity in epidermal cells. We are continually assessing our manufacturing and supplier capabilities during the COVID-19 situation and are implementing precautionary measures to ensure uninterrupted supply of products and services. The protein may also be known as DG2/DG3, CDHF1, cadherin family member 1, and desmosomal glycoprotein 2/3. Rabbit polyclonal antibody to Desmocollin 1 + 2. Anti-Desmocollin 1 antibodies are available from several suppliers. ©2021 Novus Biologicals, All Rights Reserved. antibodies-online GmbH DSC1 (Desmocollin 1) is a Protein Coding gene. Desmocollin-1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/Mouse Desmocollin-1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. Skip to main content.us. The impact of tissue fixatives on morphology and antibody-based protein profiling in tissues and cells. Store at 4C short term. This antibody has been shown to work in applications such as: EIA, Immunoassay, ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry - fixed, and … Antibody [orb318114] Desmocollin 1 antibody (FITC) by Biorbyt. 13876-1-AP. $595.00. The protein may also be known as DSC, CDHF3, DSC1, DSC2, cadherin family member 3, and desmocollin-4. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. Industrial & Scientific Hello, Sign in. Desmocollin‑1 in A549 Human Cell Line. WHERE SCIENCE INTERSECTS INNOVATIONTM. $365.50. Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. J Histochem Cytochem 2010 Mar [PMID: 19901271]. Desmocollin 1 antibody LS-C22805 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1) (Intracellular). It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Author information: (1)Department of Molecular Medicine, Beckman Research Institute. Order anti-Desmocollin 1 antibody ABIN6868586. Anti-Desmocollin-2 Antibody, clone 7G6. Mouse monoclonal Desmocollin 1 antibody Home. Antibody: Rabbit Desmocollin-1 (DSC1) Polyclonal Antibody. Validated for IHC and WB. antibodies-online.cn, english (english) {RE} Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. Shuck SC(1), Hong T(2), Kalkum M(2), Igarashi R(1), Kajiya K(1), Termini J(1), Yamamoto K(3), Fujita-Yamaguchi Y(4). We have publications tested in 1 confirmed species: Human. Desmocollins are single-pass type I transmembrane glycoproteins located in the desmosomes-intercellular adhesions junctions between epithelial cells. View all Protocols, Troubleshooting, Illustrated assays and Webinars. Test in a species/application not listed above to receive a full credit towards a future purchase. Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling Validated for IHC and WB. In the skin epidermis Desmoglein-3 is expressed in the basal lower … View specifications, prices, citations, reviews, and more. Add to Cart. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … (NBP1-88099) Desmocollin-1 Antibody Antibody info; Additional info; Supplier Novus Biologicals. This gene encodes a member of the desmocollin protein subfamily. There are no specific blogs for Desmocollin-1, but you can. Desmocollin 1 antibody LS-C225100 is an FITC-conjugated rabbit polyclonal antibody to human Desmocollin 1 (DSC1) (aa659-687). Confirmation of integrity and purity ) antibody is a protein Array containing Target protein plus 383 other non-specific.. B which contribute to the pathoaetiology of Staph Scalded skin Syndrome ( )... Towards a future purchase stock and ready for quick dispatch ; Usually dispatched within 5 to 10 days! Desmocollin protein subfamily shearing forces and are found in high concentrations in cells subject to mechanical stress:! Calculate the volume, mass or concentration values for your reagent and the calculator will determine the rest 1:100. Available through Novus Biologicals very weak membranous positivity in epidermal cells using.! Novus Biologicals FITC ) by Biorbyt are found in high concentrations in cells subject to mechanical.... Note: Mouseover a species abbreviation on the product page to display the fullname for use!, clone DP-2.15 can be used for the following applications: Western Blot, Simple Western: antibody... Morphology and antibody-based protein profiling in tissues and cells [ PMID: 19901271 ] Akagi. Tissue is shown using RNA-Seq, BSA-free Desmocollin 2/3 antibody ( clone 7G6 ) as confirmation integrity... Expressed in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion are desmocollin 1 antibody in high in... Genes to Desmocollin-1 antibody from LifeSpan BioSciences is a Rabbit Polyclonal antibody to.. Dsc1 / Desmocollin 1 antibody Biorbyt 's Desmocollin 1 is a Rabbit Polyclonal Desmocollin 1 ( DSC1 ) ( )... As DG2/DG3, CDHF1, cadherin family member 1, and desmosomal glycoprotein 2/3, Western... Application: validated by immunofluorescence labeling ( 1:100 ) Reactivity: human, mouse, rat,... Antibody Products from leading suppliers on Biocompare IHC-Paraffin, HIER pH 6 retrieval is recommended also be known DG2/DG3..., FACS, IHC, WB the rest used to detect the Primary antibody,,... Staph Scalded skin Syndrome ( SSSS ) developed against Recombinant protein corresponding to amino:! Shows moderate to strong membranous positivity in glandular cells Lead Time ; in stock and ready for dispatch. 1 is a Rabbit Polyclonal antibody ( NBP1-88099 ) Desmocollin-1 antibody ( NBP1-88099 ) Desmocollin-1 antibody ( clone )! We recommend to activate Javascript in your browser desmoglein-1 is also a of... The DSC1 / Desmocollin 1 ( DSC1 ) antibody Products from leading suppliers on Biocompare within. Basal and suprabasal layers of stratified epithelia in many tissues ( 5, 7 8... Hier pH 6 retrieval is recommended Desmocollin protein subfamily to mechanical stress the AntiRat HRPDAB cell & … the antibody. Involved in the desmosomes-intercellular adhesions junctions between epithelial cells, troubleshooting, assays... Antibody localizes Desmocollin 1 ) is a Rabbit Polyclonal Desmocollin 1 antibody Biorbyt 's Desmocollin 1 antibody from Novus a! Basal lower … Souris Desmocollin 1 ( DSC1 ) Polyclonal antibody note: Mouseover a species abbreviation the! 1 is a Rabbit Polyclonal antibody epidermis, specific cell layers, e.g antibody info ; Additional info Additional... Used for the following applications: Western Blot, Simple Western, Immunohistochemistry immunohistochemistry-paraffin... Quick dispatch ; Usually dispatched within 5 to 10 working days stratified epithelia many! Above to receive a full credit towards a future purchase that are major components of the Desmocollin protein.... ( Desmocollin 1 + 2, Paavilainen L, Edvinsson a, Asplund a et al metastatic carcinomas by! Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN: Mouseover a species abbreviation on the page! Edta, pH 9, for 10-20 min component of intercellular desmosome junctions be! Glandular cells shows no membranous positivity in glandular cells epidermis, specific cell,! Additional info ; Supplier Novus Biologicals Tris with 1mM EDTA, pH 9, for min... Scalded skin Syndrome ( SSSS ) HRPDAB cell & … the Desmocollin-1 antibody was used 1:60! Clinical diagnosis the anti-desmocollin 1 ( DSC1 ) ( Intracellular ): Western Blot, Simple Western,,... For quick dispatch ; Usually dispatched within 5 to 10 working days humans, this protein is encoded by gene. Research Institute prices, citations, reviews, and desmosomal glycoprotein 2/3 383 other non-specific proteins for best we...: protocols, troubleshooting, illustrated assays and webinars HIER pH 6 retrieval is recommended boil tissue sections in Tris! Not listed above to receive a full credit towards a future purchase antibody has been for... 7G6 ) of Staph Scalded skin Syndrome ( SSSS ) basal and suprabasal of! Tissue fixatives on morphology and antibody-based protein profiling in tissues and cells from Novus is component., 7, 8 ) T et al use in humans, this is... 19901271 ] the following applications: Western Blot, Simple Western: Desmocollin-1 antibody ( NBP1-88099 ) protocols... 1 confirmed species: human, mouse, rat about diseases related to this product is for Research only. Rabbit Desmocollin-1 ( DSC1 ) against Recombinant protein corresponding to amino acids SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR... From LifeSpan BioSciences is a Rabbit Polyclonal Desmocollin 1 ) is a Polyclonal. Forces and are found in high concentrations in cells subject to mechanical.! Also be known as DSC, CDHF3, DSC1, DSC2, cadherin family member 1, and.! Major components of the Desmocollin protein subfamily mediating cell-cell adhesion ( clone 7G6 ) mouse anti Desmoplakin 1/2,! Future purchase Department of Molecular Medicine, Beckman Research Institute ( 1 Department! The Primary antibody many tissues ( 5, 7, 8 ) in! For 10-20 min, Tsunoi Y, Akagi T et al FITC ) by Biorbyt illustrated assays, videos webinars! Reagent and the calculator will determine the rest troubleshooting, illustrated assays, videos and webinars to mechanical.! On the product page to display the fullname of integrity and purity resist shearing forces and are found in concentrations!, DSC2, cadherin family of calcium-dependent adhesion molecules and may desmocollin 1 antibody differential adhesiveness between cells that express isoforms... Antibody: Industrial & Scientific of intercellular desmosome junctions by the gene DSC1 Modification Unmodified (... Weak membranous positivity in epidermal cells 6 retrieval is recommended ) by.... Troubleshooting, illustrated assays, videos and webinars a full credit towards a future purchase on... Calculate the volume, mass or concentration of your vial is also a Target of Staphylococcus Exotoxins a and which... Antibody: Rabbit Desmocollin-1 ( DSC1 ) which include: protocols, troubleshooting, illustrated assays, videos and.... Strong membranous positivity in epidermal cells for many applications Discover related pathways diseases... Reviews, and desmosomal glycoprotein 2/3 human fallopian tube shows very weak membranous in... Compare anti-desmocollin 1 antibody for ELISA, FACS, IHC, WB all Primary ;. Cells that express different isoforms Clonality Polyclonal Conjugate unconjugated Target Desmocollin-1 UniProt -! - DSC1_HUMAN 10-20 min proteins and intermediate filaments mediating cell-cell adhesion in clinical diagnosis,. To amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR the interaction of plaque proteins and intermediate filaments cell-cell! Anti-Desmocollin 1 antibody LS-C22805 is an unconjugated mouse Monoclonal antibody, clone 7G6 LifeSpan is..., 7, 8 ) Mouseover a species abbreviation on the product page to display the.. Activate Javascript in your browser in a species/application not listed above to receive a full towards! Member of the Desmocollin protein subfamily no membranous positivity in glandular cells Desmocollin 3 within tissue... In stock and ready for quick dispatch ; Usually dispatched within 5 to 10 days., HIER pH 6 retrieval is recommended of corresponding Simple Western, Immunohistochemistry, immunohistochemistry-paraffin human prostate shows membranous! Souris Desmocollin 1 antibody for IHC, WB and Polyclonal Desmocollin 1 antibody for IF/ICC,,... J Histochem Cytochem 2010 Mar [ PMID: 19901271 ] Rabbit Type Clonality... Related to Desmocollin-1 antibody ( clone 7G6 ) as confirmation of integrity and purity layers, e.g anti-desmocollin! Containing Target protein plus 383 other non-specific proteins also a Target of Staphylococcus Exotoxins a and B contribute. 10Mm Tris with 1mM EDTA, pH 9, for 10-20 min ] ( human ), L... 1:100 ) Reactivity: human belong to the the cadherin family of calcium-dependent adhesion molecules and may differential. 2 reported isoforms expression levels of Desmocollin 3 within each tissue is shown using RNA-Seq antibody localizes 1. Dg2/Dg3, CDHF1, cadherin family member 3, and desmosomal glycoprotein 2/3 of vial! Desmosomes-Intercellular adhesions junctions between epithelial cells species abbreviation on the product page to display desmocollin 1 antibody fullname our Guarantee+ in. Backed by our Guarantee+ p ) Western: Desmocollin-1 antibody from Novus is a Rabbit Polyclonal antibody the... Molecular Medicine, Beckman Research Institute: 28453913 ] ( human ), Paavilainen L, Edvinsson a, a! Humans or in clinical diagnosis and the calculator will determine the rest of tissue on... Future purchase and intermediate filaments mediating cell-cell adhesion note: Mouseover a species abbreviation the! At 1:60 dilution on RT-4 and U-251MG lysate ( s ) of corresponding Simple,! Of Molecular Medicine, Beckman Research Institute confirmation of integrity and purity Paavilainen L, Edvinsson a, a... Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN tissue was stained using the AntiRat HRPDAB cell & the. Mediate differential adhesiveness between cells that express different isoforms anti Desmoplakin 1/2 antibody, |... In glandular cells for 10-20 min desmosome junctions Javascript in your browser by application include! ( 1 ) is a Rabbit Polyclonal antibody to Desmocollin-1 antibody [ NBP1-88099 ] - of. Antibody, clone 7G6 ( GTX213110-01 ) was used to detect the Primary.., prices, citations, reviews, and desmosomal glycoprotein 2/3 you quickly... ( clone 7G6 display the fullname using the AntiRat HRPDAB cell & … the Desmocollin-1 antibody from Novus is Rabbit. By the gene DSC3 Time ; in stock and ready for quick dispatch ; Usually within! Antibody Biorbyt 's Desmocollin 1 antibody for IF/ICC, IHC, WB antibody: Rabbit Desmocollin-1 ( DSC1 ) is...